![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab7 [110540] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142230] (2 PDB entries) |
![]() | Domain d1t91d1: 1t91 D:7-182 [119195] automatically matched to 1T91 A:7-182 complexed with gtp, mg; mutant |
PDB Entry: 1t91 (more details), 1.9 Å
SCOP Domain Sequences for d1t91d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t91d1 c.37.1.8 (D:7-182) Rab7 {Human (Homo sapiens) [TaxId: 9606]} vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
Timeline for d1t91d1: