Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab7 [110540] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [142230] (2 PDB entries) Uniprot P51149 7-182 |
Domain d1t91c_: 1t91 C: [119194] automated match to d1vg0b_ complexed with gtp, mg |
PDB Entry: 1t91 (more details), 1.9 Å
SCOPe Domain Sequences for d1t91c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t91c_ c.37.1.8 (C:) Rab7 {Human (Homo sapiens) [TaxId: 9606]} vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
Timeline for d1t91c_: