SCOPe 2.01: Domain d1t91c_: 1t91 C:

Lineage for d1t91c_ (1t91 C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab7 [110540] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142230] (2 PDB entries)
   Uniprot P51149 7-182

8. Domain d1t91c_: 1t91 C: [119194]
   automated match to d1vg0b_
   complexed with gtp, mg

Details for d1t91c_

PDB Entry: 1t91, 1.9 Å

PDB Description: crystal structure of human small gtpase rab7(gtp)

PDB Compounds: (C:) Ras-related protein Rab-7

SCOPe Domain Sequences for d1t91c_:

Sequence; same for both SEQRES and ATOM records:

>d1t91c_ c.37.1.8 (C:) Rab7 {Human (Homo sapiens) [TaxId: 9606]}
vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel

Timeline for d1t91c_:

• d1t91c_ first appeared in SCOP 1.73, called d1t91c1
  
• d1t91c_ was called d1t91c1 in SCOP 1.75
  
• d1t91c_ appears in SCOPe 2.02
  
• d1t91c_ appears in the current release, SCOPe 2.08