Lineage for d1t91b1 (1t91 B:7-182)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696174Protein Rab7 [110540] (2 species)
  7. 696175Species Human (Homo sapiens) [TaxId:9606] [142230] (2 PDB entries)
  8. 696177Domain d1t91b1: 1t91 B:7-182 [119193]
    automatically matched to 1T91 A:7-182
    complexed with gtp, mg; mutant

Details for d1t91b1

PDB Entry: 1t91 (more details), 1.9 Å

PDB Description: crystal structure of human small gtpase rab7(gtp)
PDB Compounds: (B:) Ras-related protein Rab-7

SCOP Domain Sequences for d1t91b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t91b1 c.37.1.8 (B:7-182) Rab7 {Human (Homo sapiens) [TaxId: 9606]}
vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel

SCOP Domain Coordinates for d1t91b1:

Click to download the PDB-style file with coordinates for d1t91b1.
(The format of our PDB-style files is described here.)

Timeline for d1t91b1: