![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab7 [110540] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142230] (2 PDB entries) Uniprot P51149 7-182 |
![]() | Domain d1t91a1: 1t91 A:7-182 [119192] complexed with gtp, mg |
PDB Entry: 1t91 (more details), 1.9 Å
SCOPe Domain Sequences for d1t91a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t91a1 c.37.1.8 (A:7-182) Rab7 {Human (Homo sapiens) [TaxId: 9606]} vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
Timeline for d1t91a1: