Lineage for d1t8va1 (1t8v A:1-131)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414619Protein Intestinal fatty acid binding protein [50851] (2 species)
  7. 2414631Species Norway rat (Rattus norvegicus) [TaxId:10116] [50852] (12 PDB entries)
    Uniprot P02693
  8. 2414642Domain d1t8va1: 1t8v A:1-131 [119191]

Details for d1t8va1

PDB Entry: 1t8v (more details)

PDB Description: the nmr structure of d34a i-fabp: implications for the determinants of ligand binding stoichiometry
PDB Compounds: (A:) Fatty acid-binding protein, intestinal

SCOPe Domain Sequences for d1t8va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8va1 b.60.1.2 (A:1-131) Intestinal fatty acid binding protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
afdgtwkvdrnenyekfmekmginvvkrklgahanlkltitqegnkftvkessnfrnidv
vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
gveakrifkke

SCOPe Domain Coordinates for d1t8va1:

Click to download the PDB-style file with coordinates for d1t8va1.
(The format of our PDB-style files is described here.)

Timeline for d1t8va1: