![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Intestinal fatty acid binding protein [50851] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [50852] (12 PDB entries) Uniprot P02693 |
![]() | Domain d1t8va1: 1t8v A:1-131 [119191] |
PDB Entry: 1t8v (more details)
SCOPe Domain Sequences for d1t8va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t8va1 b.60.1.2 (A:1-131) Intestinal fatty acid binding protein {Norway rat (Rattus norvegicus) [TaxId: 10116]} afdgtwkvdrnenyekfmekmginvvkrklgahanlkltitqegnkftvkessnfrnidv vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye gveakrifkke
Timeline for d1t8va1: