Lineage for d1t8va1 (1t8v A:1-131)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673924Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 674027Protein Intestinal fatty acid binding protein [50851] (2 species)
  7. 674032Species Rat (Rattus norvegicus) [TaxId:10116] [50852] (11 PDB entries)
  8. 674042Domain d1t8va1: 1t8v A:1-131 [119191]
    mutant

Details for d1t8va1

PDB Entry: 1t8v (more details)

PDB Description: the nmr structure of d34a i-fabp: implications for the determinants of ligand binding stoichiometry
PDB Compounds: (A:) Fatty acid-binding protein, intestinal

SCOP Domain Sequences for d1t8va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8va1 b.60.1.2 (A:1-131) Intestinal fatty acid binding protein {Rat (Rattus norvegicus) [TaxId: 10116]}
afdgtwkvdrnenyekfmekmginvvkrklgahanlkltitqegnkftvkessnfrnidv
vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
gveakrifkke

SCOP Domain Coordinates for d1t8va1:

Click to download the PDB-style file with coordinates for d1t8va1.
(The format of our PDB-style files is described here.)

Timeline for d1t8va1: