Lineage for d1t8od_ (1t8o D:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. Protein automated matches [190046] (3 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)
  8. Domain d1t8od_: 1t8o D: [119190]
    Other proteins in same PDB: d1t8oa_, d1t8oc_
    automated match to d1p2qb_
    complexed with so4; mutant

Details for d1t8od_

PDB Entry: 1t8o (more details), 1.7 Å

PDB Description: crystal structure of the p1 trp bpti mutant- bovine chymotrypsin complex
PDB Compounds: (D:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1t8od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8od_ g.8.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpcwariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d1t8od_ are not available.

Timeline for d1t8od_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t8oa_, d1t8ob_, d1t8oc_