SCOP 1.75: Domain d1t8nd1: 1t8n D:3-58

Lineage for d1t8nd1 (1t8n D:3-58)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (3 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)

6. Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57365] (81 PDB entries)

8. Domain d1t8nd1: 1t8n D:3-58 [119186]
   Other proteins in same PDB: d1t8na1, d1t8nc1
   automatically matched to d3btti_
   complexed with so4; mutant

Details for d1t8nd1

PDB Entry: 1t8n, 1.75 Å

PDB Description: crystal structure of the p1 thr bpti mutant- bovine chymotrypsin complex

PDB Compounds: (D:) pancreatic trypsin inhibitor

SCOP Domain Sequences for d1t8nd1:

Sequence; same for both SEQRES and ATOM records:

>d1t8nd1 g.8.1.1 (D:3-58) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
dfcleppytgpctariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

Timeline for d1t8nd1:

• d1t8nd1 first appeared in SCOP 1.73
  
• d1t8nd1 is called d1t8nd_ in SCOPe 2.01
  
• d1t8nd1 appears in the current release, SCOPe 2.08, called d1t8nd_