Lineage for d1t8nc_ (1t8n C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
    Uniprot P00766
  8. Domain d1t8nc_: 1t8n C: [119185]
    Other proteins in same PDB: d1t8nb_, d1t8nd_
    automated match to d1acbe_
    complexed with so4; mutant

Details for d1t8nc_

PDB Entry: 1t8n (more details), 1.75 Å

PDB Description: crystal structure of the p1 thr bpti mutant- bovine chymotrypsin complex
PDB Compounds: (C:) Chymotrypsin A

SCOPe Domain Sequences for d1t8nc_:

Sequence, based on SEQRES records: (download)

>d1t8nc_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1t8nc_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOPe Domain Coordinates for d1t8nc_ are not available.

Timeline for d1t8nc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t8na_, d1t8nb_, d1t8nd_