![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50523] (56 PDB entries) Uniprot P00766 |
![]() | Domain d1t8na1: 1t8n A:1-245 [119183] Other proteins in same PDB: d1t8nb1, d1t8nd1 automatically matched to d1acbe_ complexed with so4; mutant |
PDB Entry: 1t8n (more details), 1.75 Å
SCOP Domain Sequences for d1t8na1:
Sequence, based on SEQRES records: (download)
>d1t8na1 b.47.1.2 (A:1-245) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq tlaan
>d1t8na1 b.47.1.2 (A:1-245) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp sasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagas gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
Timeline for d1t8na1: