Lineage for d1t8md_ (1t8m D:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637462Protein automated matches [190046] (3 species)
    not a true protein
  7. 2637463Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)
  8. 2637500Domain d1t8md_: 1t8m D: [119182]
    Other proteins in same PDB: d1t8ma_, d1t8mc_
    automated match to d1bpi__
    complexed with so4; mutant

Details for d1t8md_

PDB Entry: 1t8m (more details), 1.8 Å

PDB Description: crystal structure of the p1 his bpti mutant- bovine chymotrypsin complex
PDB Compounds: (D:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1t8md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8md_ g.8.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpchariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d1t8md_:

Click to download the PDB-style file with coordinates for d1t8md_.
(The format of our PDB-style files is described here.)

Timeline for d1t8md_: