Lineage for d1t8mc_ (1t8m C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2055878Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2055879Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
    Uniprot P00766
  8. 2055897Domain d1t8mc_: 1t8m C: [119181]
    Other proteins in same PDB: d1t8mb_, d1t8md_
    automated match to d1acbe_
    complexed with so4; mutant

Details for d1t8mc_

PDB Entry: 1t8m (more details), 1.8 Å

PDB Description: crystal structure of the p1 his bpti mutant- bovine chymotrypsin complex
PDB Compounds: (C:) Chymotrypsin A

SCOPe Domain Sequences for d1t8mc_:

Sequence, based on SEQRES records: (download)

>d1t8mc_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1t8mc_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOPe Domain Coordinates for d1t8mc_:

Click to download the PDB-style file with coordinates for d1t8mc_.
(The format of our PDB-style files is described here.)

Timeline for d1t8mc_: