Lineage for d1t8ld1 (1t8l D:3-58)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748504Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 748505Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 748506Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 748544Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 748545Species Cow (Bos taurus) [TaxId:9913] [57365] (75 PDB entries)
  8. 748563Domain d1t8ld1: 1t8l D:3-58 [119178]
    Other proteins in same PDB: d1t8la1, d1t8lc1
    automatically matched to d3btmi_
    complexed with so4; mutant

Details for d1t8ld1

PDB Entry: 1t8l (more details), 1.75 Å

PDB Description: crystal structure of the p1 met bpti mutant- bovine chymotrypsin complex
PDB Compounds: (D:) pancreatic trypsin inhibitor

SCOP Domain Sequences for d1t8ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8ld1 g.8.1.1 (D:3-58) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
dfcleppytgpcmariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOP Domain Coordinates for d1t8ld1:

Click to download the PDB-style file with coordinates for d1t8ld1.
(The format of our PDB-style files is described here.)

Timeline for d1t8ld1: