Lineage for d1t8lb_ (1t8l B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259421Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2259611Protein automated matches [190046] (4 species)
    not a true protein
  7. 2259612Species Cow (Bos taurus) [TaxId:9913] [186767] (13 PDB entries)
  8. 2259632Domain d1t8lb_: 1t8l B: [119176]
    Other proteins in same PDB: d1t8la_, d1t8lc_
    automated match to d1p2ki_
    complexed with so4; mutant

Details for d1t8lb_

PDB Entry: 1t8l (more details), 1.75 Å

PDB Description: crystal structure of the p1 met bpti mutant- bovine chymotrypsin complex
PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1t8lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8lb_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrpdfcleppytgpcmariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d1t8lb_:

Click to download the PDB-style file with coordinates for d1t8lb_.
(The format of our PDB-style files is described here.)

Timeline for d1t8lb_: