Lineage for d1t8ia3 (1t8i A:201-430)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1235215Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 1235216Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
  5. 1235217Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 1235218Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 1235221Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 1235232Domain d1t8ia3: 1t8i A:201-430 [119174]
    Other proteins in same PDB: d1t8ia1, d1t8ia2
    automatically matched to d1k4sa2
    protein/DNA complex; complexed with ehd

Details for d1t8ia3

PDB Entry: 1t8i (more details), 3 Å

PDB Description: human dna topoisomerase i (70 kda) in complex with the poison camptothecin and covalent complex with a 22 base pair dna duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1t8ia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t8ia3 e.15.1.1 (A:201-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
qkwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatff
akmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqms
keeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpe
diiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOPe Domain Coordinates for d1t8ia3:

Click to download the PDB-style file with coordinates for d1t8ia3.
(The format of our PDB-style files is described here.)

Timeline for d1t8ia3: