SCOPe 2.08: Domain d1t8da_: 1t8d A:

Lineage for d1t8da_ (1t8d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143958] (14 PDB entries)
   Uniprot P06734 156-298

8. Domain d1t8da_: 1t8d A: [119171]
   automated match to d1t8da1

Details for d1t8da_

PDB Entry: 1t8d

PDB Description: structure of the c-type lectin domain of cd23

PDB Compounds: (A:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d1t8da_:

Sequence; same for both SEQRES and ATOM records:

>d1t8da_ d.169.1.1 (A:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdr
klgawvcdrlatctppasegsae

Timeline for d1t8da_:

• d1t8da_ first appeared in SCOP 1.73, called d1t8da1
  
• d1t8da_ appears in SCOPe 2.07