SCOP 1.75: Domain d1t7ia1: 1t7i A:1-99

Lineage for d1t7ia1 (1t7i A:1-99)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (3 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries)

8. Domain d1t7ia1: 1t7i A:1-99 [119166]
   automatically matched to d1k6ca_
   complexed with 017, act, po4; mutant

Details for d1t7ia1

PDB Entry: 1t7i, 1.35 Å

PDB Description: the structural and thermodynamic basis for the binding of tmc114, a next-generation hiv-1 protease inhibitor.

PDB Compounds: (A:) Pol polyprotein

SCOP Domain Sequences for d1t7ia1:

Sequence; same for both SEQRES and ATOM records:

>d1t7ia1 b.50.1.1 (A:1-99) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d1t7ia1:

• d1t7ia1 first appeared in SCOP 1.73
  
• d1t7ia1 is called d1t7ia_ in SCOPe 2.01
  
• d1t7ia1 appears in the current release, SCOPe 2.08, called d1t7ia_