![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (2 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species) |
![]() | Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries) |
![]() | Domain d1t7ia1: 1t7i A:1-99 [119166] automatically matched to d1k6ca_ complexed with 017, act, po4; mutant |
PDB Entry: 1t7i (more details), 1.35 Å
SCOP Domain Sequences for d1t7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7ia1 b.50.1.1 (A:1-99) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptptnvigrnlltqigctlnf
Timeline for d1t7ia1: