![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
![]() | Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
![]() | Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
![]() | Protein automated matches [190046] (3 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries) |
![]() | Domain d1t7cb_: 1t7c B: [119163] Other proteins in same PDB: d1t7ca_, d1t7cc_ automated match to d1bpi__ complexed with so4; mutant |
PDB Entry: 1t7c (more details), 1.85 Å
SCOPe Domain Sequences for d1t7cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7cb_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} rpdfcleppytgpceariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga
Timeline for d1t7cb_: