SCOPe 2.08: Domain d1t7cb_: 1t7c B:

Lineage for d1t7cb_ (1t7c B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)

8. Domain d1t7cb_: 1t7c B: [119163]
   Other proteins in same PDB: d1t7ca_, d1t7cc_
   automated match to d1bpi__
   complexed with so4; mutant

Details for d1t7cb_

PDB Entry: 1t7c, 1.85 Å

PDB Description: crystal structure of the p1 glu bpti mutant- bovine chymotrypsin complex

PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1t7cb_:

Sequence; same for both SEQRES and ATOM records:

>d1t7cb_ g.8.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpceariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

Timeline for d1t7cb_:

• d1t7cb_ first appeared in SCOP 1.73, called d1t7cb1
  
• d1t7cb_ appears in SCOPe 2.07