Lineage for d1t7ca1 (1t7c A:1-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670329Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 670330Species Cow (Bos taurus) [TaxId:9913] [50523] (56 PDB entries)
  8. 670356Domain d1t7ca1: 1t7c A:1-245 [119162]
    Other proteins in same PDB: d1t7cb1, d1t7cd1
    automatically matched to d1acbe_
    complexed with so4; mutant

Details for d1t7ca1

PDB Entry: 1t7c (more details), 1.85 Å

PDB Description: crystal structure of the p1 glu bpti mutant- bovine chymotrypsin complex
PDB Compounds: (A:) Chymotrypsin A

SCOP Domain Sequences for d1t7ca1:

Sequence, based on SEQRES records: (download)

>d1t7ca1 b.47.1.2 (A:1-245) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1t7ca1 b.47.1.2 (A:1-245) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOP Domain Coordinates for d1t7ca1:

Click to download the PDB-style file with coordinates for d1t7ca1.
(The format of our PDB-style files is described here.)

Timeline for d1t7ca1: