Lineage for d1t68x1 (1t68 X:0-179)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 protein domains)
    barrel, closed; n=8, S=12, meander
  6. 673795Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 673796Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
  8. 673804Domain d1t68x1: 1t68 X:0-179 [119160]
    automatically matched to d1euoa_
    complexed with hem, no

Details for d1t68x1

PDB Entry: 1t68 (more details), 1.45 Å

PDB Description: crystal structure of nitrophorin 2 complex with no
PDB Compounds: (X:) Nitrophorin 2

SCOP Domain Sequences for d1t68x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t68x1 b.60.1.1 (X:0-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOP Domain Coordinates for d1t68x1:

Click to download the PDB-style file with coordinates for d1t68x1.
(The format of our PDB-style files is described here.)

Timeline for d1t68x1: