Lineage for d1t65a_ (1t65 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2011947Protein Androgen receptor [63621] (4 species)
  7. 2011957Species Human (Homo sapiens) [TaxId:9606] [63623] (62 PDB entries)
    Uniprot P10275 671-919
  8. 2011968Domain d1t65a_: 1t65 A: [119159]
    automated match to d1e3ga_
    complexed with dht

Details for d1t65a_

PDB Entry: 1t65 (more details), 1.66 Å

PDB Description: crystal structure of the androgen receptor ligand binding domain with dht and a peptide derived form its physiological coactivator grip1 nr box 2 bound in a non-helical conformation
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1t65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t65a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfhtq

SCOPe Domain Coordinates for d1t65a_:

Click to download the PDB-style file with coordinates for d1t65a_.
(The format of our PDB-style files is described here.)

Timeline for d1t65a_: