Lineage for d1t5za1 (1t5z A:669-918)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776485Protein Androgen receptor [63621] (3 species)
  7. 776495Species Human (Homo sapiens) [TaxId:9606] [63623] (36 PDB entries)
    Uniprot P10275 671-919
  8. 776520Domain d1t5za1: 1t5z A:669-918 [119157]
    automatically matched to d1e3ga_
    complexed with dht

Details for d1t5za1

PDB Entry: 1t5z (more details), 2.3 Å

PDB Description: Crystal Structure of the Androgen Receptor Ligand Binding Domain (LBD) with DHT and a peptide derived from its physiological coactivator ARA70
PDB Compounds: (A:) Androgen receptor

SCOP Domain Sequences for d1t5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5za1 a.123.1.1 (A:669-918) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfht

SCOP Domain Coordinates for d1t5za1:

Click to download the PDB-style file with coordinates for d1t5za1.
(The format of our PDB-style files is described here.)

Timeline for d1t5za1: