SCOPe 2.08: Domain d1t4tb_: 1t4t B:

Lineage for d1t4tb_ (1t4t B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
   Uniprot P07824

8. Domain d1t4tb_: 1t4t B: [119152]
   automated match to d1hqfa_
   complexed with dir, mn

Details for d1t4tb_

PDB Entry: 1t4t, 2.2 Å

PDB Description: arginase-dinor-NOHA complex

PDB Compounds: (B:) arginase 1

SCOPe Domain Sequences for d1t4tb_:

Sequence; same for both SEQRES and ATOM records:

>d1t4tb_ c.42.1.1 (B:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

Timeline for d1t4tb_:

• d1t4tb_ first appeared in SCOP 1.73, called d1t4tb1
  
• d1t4tb_ appears in SCOPe 2.07