Lineage for d1t4pb1 (1t4p B:6-319)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 832711Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 832712Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 832713Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
    Pfam PF00491
  6. 832734Protein Arginase [52770] (5 species)
  7. 832790Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries)
    Uniprot P07824
  8. 832837Domain d1t4pb1: 1t4p B:6-319 [119146]
    automatically matched to d1hqfa_
    complexed with 2bh, mn

Details for d1t4pb1

PDB Entry: 1t4p (more details), 2.6 Å

PDB Description: Arginase-dehydro-ABH complex
PDB Compounds: (B:) arginase 1

SCOP Domain Sequences for d1t4pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4pb1 c.42.1.1 (B:6-319) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOP Domain Coordinates for d1t4pb1:

Click to download the PDB-style file with coordinates for d1t4pb1.
(The format of our PDB-style files is described here.)

Timeline for d1t4pb1: