SCOP 1.73: Domain d1t4eb1: 1t4e B:25-109

Lineage for d1t4eb1 (1t4e B:25-109)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (6 PDB entries)

8. Domain d1t4eb1: 1t4e B:25-109 [119143]
   automatically matched to d1ycra_
   complexed with diz; mutant

Details for d1t4eb1

PDB Entry: 1t4e, 2.6 Å

PDB Description: structure of human mdm2 in complex with a benzodiazepine inhibitor

PDB Compounds: (B:) ubiquitin-protein ligase e3 mdm2

SCOP Domain Sequences for d1t4eb1:

Sequence; same for both SEQRES and ATOM records:

>d1t4eb1 a.42.1.1 (B:25-109) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

Timeline for d1t4eb1:

• d1t4eb1 is new in SCOP 1.73
  
• d1t4eb1 appears in SCOP 1.75
  
• d1t4eb1 appears in the current release, SCOPe 2.08, called d1t4eb2