Lineage for d1t4eb2 (1t4e B:17-111)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712390Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2712526Domain d1t4eb2: 1t4e B:17-111 [119143]
    Other proteins in same PDB: d1t4ea3, d1t4eb3
    automated match to d1rv1a_
    complexed with diz

Details for d1t4eb2

PDB Entry: 1t4e (more details), 2.6 Å

PDB Description: structure of human mdm2 in complex with a benzodiazepine inhibitor
PDB Compounds: (B:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1t4eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4eb2 a.42.1.1 (B:17-111) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

SCOPe Domain Coordinates for d1t4eb2:

Click to download the PDB-style file with coordinates for d1t4eb2.
(The format of our PDB-style files is described here.)

Timeline for d1t4eb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t4eb3