Lineage for d1t4ea_ (1t4e A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
duplication: consists of two structural repeatsSuperfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) 
binds to the transactivation domain of human p53
Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
Pfam PF02201Protein MDM2 [47594] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries) 
Domain d1t4ea_: 1t4e A: [119142]
automated match to d1rv1a_
complexed with diz
Details for d1t4ea_
PDB Entry: 1t4e (more details), 2.6 Å
PDB Description: structure of human mdm2 in complex with a benzodiazepine inhibitor
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2SCOPe Domain Sequences for d1t4ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t4ea_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
SCOPe Domain Coordinates for d1t4ea_:
Click to download the PDB-style file with coordinates for d1t4ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t4ea_:
- d1t4ea_ first appeared in SCOP 1.73, called d1t4ea1
- d1t4ea_ appears in SCOPe 2.04
- d1t4ea_ is called d1t4ea2 in SCOPe 2.06
- d1t4ea_ appears in the current release, SCOPe 2.08, called d1t4ea2
View in 3D
