Lineage for d1t3ya1 (1t3y A:2-131)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870460Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870461Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 870571Family d.109.1.2: Cofilin-like [55762] (7 proteins)
  6. 870576Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)
  7. 870577Species Human (Homo sapiens) [TaxId:9606] [111107] (5 PDB entries)
    Uniprot Q14019
  8. 870578Domain d1t3ya1: 1t3y A:2-131 [119141]
    automatically matched to d1wnja_

Details for d1t3ya1

PDB Entry: 1t3y (more details), 1.15 Å

PDB Description: Three Crystal Structures of Human Coactosin-like Protein
PDB Compounds: (A:) Coactosin-like protein

SCOP Domain Sequences for d1t3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ya1 d.109.1.2 (A:2-131) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]}
atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
edfikselkk

SCOP Domain Coordinates for d1t3ya1:

Click to download the PDB-style file with coordinates for d1t3ya1.
(The format of our PDB-style files is described here.)

Timeline for d1t3ya1: