SCOPe 2.07: Domain d1t31a_: 1t31 A:

Lineage for d1t31a_ (1t31 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Chymase (mast cell protease I) [89343] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries)

8. Domain d1t31a_: 1t31 A: [119135]
   automated match to d1pjpa_
   complexed with co, mes, nag, ohh, so4

Details for d1t31a_

PDB Entry: 1t31, 1.9 Å

PDB Description: a dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation

PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d1t31a_:

Sequence; same for both SEQRES and ATOM records:

>d1t31a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Timeline for d1t31a_:

• d1t31a_ first appeared in SCOP 1.73, called d1t31a1
  
• d1t31a_ appears in SCOPe 2.06
  
• d1t31a_ appears in the current release, SCOPe 2.08