Lineage for d1t31a1 (1t31 A:16-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670476Protein Chymase II (mast cell proteinase II) [50552] (2 species)
  7. 670477Species Human (Homo sapiens) [TaxId:9606] [50554] (4 PDB entries)
  8. 670479Domain d1t31a1: 1t31 A:16-245 [119135]
    automatically matched to d1pjpa_
    complexed with co, mes, nag, ohh, so4

Details for d1t31a1

PDB Entry: 1t31 (more details), 1.9 Å

PDB Description: a dual inhibitor of the leukocyte proteases cathepsin g and chymase with therapeutic efficacy in animals models of inflammation
PDB Compounds: (A:) Chymase

SCOP Domain Sequences for d1t31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t31a1 b.47.1.2 (A:16-245) Chymase II (mast cell proteinase II) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

SCOP Domain Coordinates for d1t31a1:

Click to download the PDB-style file with coordinates for d1t31a1.
(The format of our PDB-style files is described here.)

Timeline for d1t31a1: