Lineage for d1t2qh1 (1t2q H:120-220)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933318Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 933627Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 933658Domain d1t2qh1: 1t2q H:120-220 [119134]
    automatically matched to d1fnsh2
    complexed with gol, mes

Details for d1t2qh1

PDB Entry: 1t2q (more details), 1.83 Å

PDB Description: The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen
PDB Compounds: (H:) Fab NNA7 Light Chain

SCOPe Domain Sequences for d1t2qh1:

Sequence, based on SEQRES records: (download)

>d1t2qh1 b.1.1.2 (H:120-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d1t2qh1 b.1.1.2 (H:120-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d1t2qh1:

Click to download the PDB-style file with coordinates for d1t2qh1.
(The format of our PDB-style files is described here.)

Timeline for d1t2qh1: