Lineage for d1t2qh_ (1t2q H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744228Domain d1t2qh_: 1t2q H: [119134]
    Other proteins in same PDB: d1t2ql2
    automated match to d6shgh_
    complexed with gol, mes

Details for d1t2qh_

PDB Entry: 1t2q (more details), 1.83 Å

PDB Description: The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen
PDB Compounds: (H:) Fab NNA7 Light Chain

SCOPe Domain Sequences for d1t2qh_:

Sequence, based on SEQRES records: (download)

>d1t2qh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdy
naafisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssa
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records): (download)

>d1t2qh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdy
naafisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssa
kttppsvyplapgsasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d1t2qh_:

Click to download the PDB-style file with coordinates for d1t2qh_.
(The format of our PDB-style files is described here.)

Timeline for d1t2qh_: