Lineage for d1t2ma1 (1t2m A:2-93)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785886Protein Afadin [141269] (1 species)
  7. 2785887Species Human (Homo sapiens) [TaxId:9606] [141270] (2 PDB entries)
    Uniprot P55196 985-1079! Uniprot P55196 987-1077
  8. 2785888Domain d1t2ma1: 1t2m A:2-93 [119133]

Details for d1t2ma1

PDB Entry: 1t2m (more details)

PDB Description: solution structure of the pdz domain of af-6
PDB Compounds: (A:) AF-6 protein

SCOPe Domain Sequences for d1t2ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]}
kepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqllsvd
grslvglsqeraaelmtrtssvvtlevakqga

SCOPe Domain Coordinates for d1t2ma1:

Click to download the PDB-style file with coordinates for d1t2ma1.
(The format of our PDB-style files is described here.)

Timeline for d1t2ma1: