Lineage for d1t1ua2 (1t1u A:402-616)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130379Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2130380Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2130473Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 2130513Protein Choline O-acetyltransferase [110591] (2 species)
  7. 2130523Species Norway rat (Rattus norvegicus) [TaxId:10116] [110592] (2 PDB entries)
    Uniprot P32738
  8. 2130525Domain d1t1ua2: 1t1u A:402-616 [119111]
    automated match to d1q6xa2

Details for d1t1ua2

PDB Entry: 1t1u (more details), 1.55 Å

PDB Description: Structural Insights and Functional Implications of Choline Acetyltransferase
PDB Compounds: (A:) choline O-acetyltransferase

SCOPe Domain Sequences for d1t1ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1ua2 c.43.1.3 (A:402-616) Choline O-acetyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfivykfdnygktfikkqkyspdgfiqvalqlayyrlyqrlvptyesasirrfqegrvdn
irsatpealafvqamtdhkaampaseklqllqtamqaqteytvmaitgmaidnhllalre
lardlckeppemfmdetylmsnrfvlstsqvpttmemfccygpvvpngygacynpqpeai
tfcissfhscketssvefaeavgaslvdmrdlcss

SCOPe Domain Coordinates for d1t1ua2:

Click to download the PDB-style file with coordinates for d1t1ua2.
(The format of our PDB-style files is described here.)

Timeline for d1t1ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t1ua1