SCOP 1.73: Domain d1t1ua1: 1t1u A:20-401

Lineage for d1t1ua1 (1t1u A:20-401)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Choline O-acetyltransferase [110591] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110592] (2 PDB entries)

8. Domain d1t1ua1: 1t1u A:20-401 [119110]
   automatically matched to d1q6xa1

Details for d1t1ua1

PDB Entry: 1t1u, 1.55 Å

PDB Description: Structural Insights and Functional Implications of Choline Acetyltransferase

PDB Compounds: (A:) choline O-acetyltransferase

SCOP Domain Sequences for d1t1ua1:

Sequence; same for both SEQRES and ATOM records:

>d1t1ua1 c.43.1.3 (A:20-401) Choline O-acetyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}
eldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkrfgapgglgetlqekllerq
ektanwvseywlndmylnnrlalpvnsspavifarqhfqdtndqlrfaaclisgvlsykt
lldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqdtlvaqkssimpepehviva
ccnqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgrsewakartv
llkdstnrdsldmierciclvcldgpgtgelsdthralqllhgggcslnganrwydkslq
fvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkklvradsvselpaprrlrwkc
spetqghlassaeklqrivknl

Timeline for d1t1ua1:

• d1t1ua1 is new in SCOP 1.73
  
• d1t1ua1 appears in SCOP 1.75
  
• d1t1ua1 appears in the current release, SCOPe 2.08