Lineage for d1t1fc1 (1t1f C:4-431)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883177Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 883178Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 883179Family e.1.1.1: Serpins [56575] (16 proteins)
  6. 883190Protein Antithrombin [56584] (2 species)
  7. 883194Species Human (Homo sapiens) [TaxId:9606] [56586] (25 PDB entries)
    Uniprot P01008
  8. 883219Domain d1t1fc1: 1t1f C:4-431 [119109]
    automatically matched to d1tb6i_
    complexed with bma, gol, iod, nag; mutant

Details for d1t1fc1

PDB Entry: 1t1f (more details), 2.75 Å

PDB Description: crystal structure of native antithrombin in its monomeric form
PDB Compounds: (C:) antithrombin-III

SCOP Domain Sequences for d1t1fc1:

Sequence, based on SEQRES records: (download)

>d1t1fc1 e.1.1.1 (C:4-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
pvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfattfy
qhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfff
aklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsr
aainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykad
gescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpev
lqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddly
vsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifm
grvanpcv

Sequence, based on observed residues (ATOM records): (download)

>d1t1fc1 e.1.1.1 (C:4-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
pvdictakprdipmnpmciyreqkipeatnrrvwelskansrfattfyqhladskndndn
iflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrkan
kasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnkte
gritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmyqe
gkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldeleemm
lcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkaflev
neegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcv

SCOP Domain Coordinates for d1t1fc1:

Click to download the PDB-style file with coordinates for d1t1fc1.
(The format of our PDB-style files is described here.)

Timeline for d1t1fc1: