SCOP 1.73: Domain d1t1ba1: 1t1b A:1-125

Lineage for d1t1ba1 (1t1b A:1-125)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (40 PDB entries)

8. Domain d1t1ba1: 1t1b A:1-125 [119105]
   automatically matched to d1ot6a_
   complexed with hc4; mutant

Details for d1t1ba1

PDB Entry: 1t1b, 1.6 Å

PDB Description: late intermediate il2 from time-resolved crystallography of the e46q mutant of pyp

PDB Compounds: (A:) Photoactive yellow protein

SCOP Domain Sequences for d1t1ba1:

Sequence; same for both SEQRES and ATOM records:

>d1t1ba1 d.110.3.1 (A:1-125) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d1t1ba1:

• d1t1ba1 is new in SCOP 1.73
  
• d1t1ba1 appears in SCOP 1.75
  
• d1t1ba1 appears in the current release, SCOPe 2.08, called d1t1ba_