Lineage for d1t1aa_ (1t1a A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1038114Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1038115Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 1038116Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 1038117Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (47 PDB entries)
    Uniprot P16113
  8. 1038153Domain d1t1aa_: 1t1a A: [119104]
    automated match to d1ot6a_
    complexed with hc4; mutant

Details for d1t1aa_

PDB Entry: 1t1a (more details), 1.6 Å

PDB Description: late intermediate il1 from time-resolved crystallography of the e46q mutant of pyp
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d1t1aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1aa_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOPe Domain Coordinates for d1t1aa_:

Click to download the PDB-style file with coordinates for d1t1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1t1aa_: