Lineage for d1t19a1 (1t19 A:1-125)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870769Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 870770Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 870771Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 870772Species Ectothiorhodospira halophila [TaxId:17] [55788] (43 PDB entries)
    Uniprot P16113
  8. 870800Domain d1t19a1: 1t19 A:1-125 [119103]
    automatically matched to d1ot6a_
    complexed with hc4; mutant

Details for d1t19a1

PDB Entry: 1t19 (more details), 1.6 Å

PDB Description: early intermediate ie2 from time-resolved crystallography of the e46q mutant of pyp
PDB Compounds: (A:) Photoactive yellow protein

SCOP Domain Sequences for d1t19a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t19a1 d.110.3.1 (A:1-125) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d1t19a1:

Click to download the PDB-style file with coordinates for d1t19a1.
(The format of our PDB-style files is described here.)

Timeline for d1t19a1: