| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.110: Profilin-like [55769] (9 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.1: PYP-like [55786] (2 proteins) |
| Protein Photoactive yellow protein, PYP [55787] (1 species) |
| Species Ectothiorhodospira halophila [TaxId:17] [55788] (40 PDB entries) |
| Domain d1t19a1: 1t19 A:1-125 [119103] automatically matched to d1ot6a_ complexed with hc4; mutant |
PDB Entry: 1t19 (more details), 1.6 Å
SCOP Domain Sequences for d1t19a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t19a1 d.110.3.1 (A:1-125) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv
Timeline for d1t19a1: