SCOPe 2.07: Domain d1t14b_: 1t14 B:

Lineage for d1t14b_ (1t14 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)

8. Domain d1t14b_: 1t14 B: [119101]
   automated match to d1oofa_
   complexed with act

Details for d1t14b_

PDB Entry: 1t14, 1.86 Å

PDB Description: Crystal structure of LUSH from Drosophila melanogaster: apo protein

PDB Compounds: (B:) lush

SCOPe Domain Sequences for d1t14b_:

Sequence; same for both SEQRES and ATOM records:

>d1t14b_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

Timeline for d1t14b_:

• d1t14b_ first appeared in SCOP 1.73, called d1t14b1
  
• d1t14b_ appears in SCOPe 2.06
  
• d1t14b_ appears in the current release, SCOPe 2.08