Lineage for d1t0va1 (1t0v A:1-174)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 805930Protein Bilin-binding protein [50837] (1 species)
  7. 805931Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries)
  8. 805941Domain d1t0va1: 1t0v A:1-174 [119099]
    mutant

Details for d1t0va1

PDB Entry: 1t0v (more details)

PDB Description: nmr solution structure of the engineered lipocalin flua(r95k) northeast structural genomics target or17
PDB Compounds: (A:) Bilin-binding protein

SCOP Domain Sequences for d1t0va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0va1 b.60.1.1 (A:1-174) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}
dvyhdgacpevkpvdnfdwsqyhgkwwevakypspngkygkcgwaeytpegksvkvsryd
vihgkeyfmegtaypvgdskigkiyhsrtvggytkktvfnvlstdnknyiigyscryded
kkghwdhvwvlsrsmvltgeaktavenyligspvvdsqklvysdfseaackvnn

SCOP Domain Coordinates for d1t0va1:

Click to download the PDB-style file with coordinates for d1t0va1.
(The format of our PDB-style files is described here.)

Timeline for d1t0va1: