Lineage for d1t0va1 (1t0v A:1-174)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673701Protein Bilin-binding protein [50837] (1 species)
  7. 673702Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries)
  8. 673712Domain d1t0va1: 1t0v A:1-174 [119099]
    mutant

Details for d1t0va1

PDB Entry: 1t0v (more details)

PDB Description: nmr solution structure of the engineered lipocalin flua(r95k) northeast structural genomics target or17
PDB Compounds: (A:) Bilin-binding protein

SCOP Domain Sequences for d1t0va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0va1 b.60.1.1 (A:1-174) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}
dvyhdgacpevkpvdnfdwsqyhgkwwevakypspngkygkcgwaeytpegksvkvsryd
vihgkeyfmegtaypvgdskigkiyhsrtvggytkktvfnvlstdnknyiigyscryded
kkghwdhvwvlsrsmvltgeaktavenyligspvvdsqklvysdfseaackvnn

SCOP Domain Coordinates for d1t0va1:

Click to download the PDB-style file with coordinates for d1t0va1.
(The format of our PDB-style files is described here.)

Timeline for d1t0va1: