SCOPe 2.08: Domain d1t0va1: 1t0v A:1-174

Lineage for d1t0va1 (1t0v A:1-174)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Bilin-binding protein [50837] (1 species)

7. Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries)

8. Domain d1t0va1: 1t0v A:1-174 [119099]
   Other proteins in same PDB: d1t0va2

Details for d1t0va1

PDB Entry: 1t0v

PDB Description: nmr solution structure of the engineered lipocalin flua(r95k) northeast structural genomics target or17

PDB Compounds: (A:) Bilin-binding protein

SCOPe Domain Sequences for d1t0va1:

Sequence; same for both SEQRES and ATOM records:

>d1t0va1 b.60.1.1 (A:1-174) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}
dvyhdgacpevkpvdnfdwsqyhgkwwevakypspngkygkcgwaeytpegksvkvsryd
vihgkeyfmegtaypvgdskigkiyhsrtvggytkktvfnvlstdnknyiigyscryded
kkghwdhvwvlsrsmvltgeaktavenyligspvvdsqklvysdfseaackvnn

Timeline for d1t0va1:

• d1t0va1 first appeared in SCOP 1.73
  
• d1t0va1 appears in SCOPe 2.07