Lineage for d1szva_ (1szv A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1923069Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 1923070Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 1923100Protein automated matches [190414] (3 species)
    not a true protein
  7. 1923116Species Mouse (Mus musculus) [TaxId:10090] [254900] (1 PDB entry)
  8. 1923117Domain d1szva_: 1szv A: [119098]
    automated match to d1szva1

Details for d1szva_

PDB Entry: 1szv (more details)

PDB Description: structure of the adaptor protein p14 reveals a profilin-like fold with novel function
PDB Compounds: (A:) Late endosomal/lysosomal Mp1 interacting protein

SCOPe Domain Sequences for d1szva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szva_ d.110.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
nqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
qvaas

SCOPe Domain Coordinates for d1szva_:

Click to download the PDB-style file with coordinates for d1szva_.
(The format of our PDB-style files is described here.)

Timeline for d1szva_: