SCOPe 2.01: Domain d1syxc_: 1syx C:

Lineage for d1syxc_ (1syx C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins)

6. Protein spliceosomal protein U5-15Kd [52896] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52897] (3 PDB entries)

8. Domain d1syxc_: 1syx C: [119082]
   Other proteins in same PDB: d1syxb1, d1syxd1, d1syxf1
   automated match to d1qgva_

Details for d1syxc_

PDB Entry: 1syx, 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex

PDB Compounds: (C:) Spliceosomal U5 snRNP-specific 15 kDa protein

SCOPe Domain Sequences for d1syxc_:

Sequence; same for both SEQRES and ATOM records:

>d1syxc_ c.47.1.8 (C:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}
ymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvd
itevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrg
arkgrglvvspkdys

Timeline for d1syxc_:

• d1syxc_ first appeared in SCOP 1.73, called d1syxc1
  
• d1syxc_ was called d1syxc1 in SCOP 1.75
  
• d1syxc_ appears in SCOPe 2.02
  
• d1syxc_ appears in the current release, SCOPe 2.08