Lineage for d1syxa_ (1syx A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992889Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins)
  6. 992890Protein spliceosomal protein U5-15Kd [52896] (1 species)
  7. 992891Species Human (Homo sapiens) [TaxId:9606] [52897] (3 PDB entries)
  8. 992893Domain d1syxa_: 1syx A: [119080]
    Other proteins in same PDB: d1syxb1, d1syxd1, d1syxf1
    automated match to d1qgva_

Details for d1syxa_

PDB Entry: 1syx (more details), 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex
PDB Compounds: (A:) Spliceosomal U5 snRNP-specific 15 kDa protein

SCOPe Domain Sequences for d1syxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syxa_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}
ymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvd
itevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrg
arkgrglvvspkdys

SCOPe Domain Coordinates for d1syxa_:

Click to download the PDB-style file with coordinates for d1syxa_.
(The format of our PDB-style files is described here.)

Timeline for d1syxa_: