SCOPe 2.07: Domain d1syib_: 1syi B:

Lineage for d1syib_ (1syi B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d1syib_: 1syi B: [119079]
   automated match to d1mm6a_
   complexed with cpw; mutant

Details for d1syib_

PDB Entry: 1syi, 2.1 Å

PDB Description: x-ray structure of the y702f mutant of the glur2 ligand-binding core (s1s2j) in complex with (s)-cpw399 at 2.1 a resolution.

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d1syib_:

Sequence; same for both SEQRES and ATOM records:

>d1syib_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyafllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgec

Timeline for d1syib_:

• d1syib_ first appeared in SCOP 1.73, called d1syib1
  
• d1syib_ appears in SCOPe 2.06
  
• d1syib_ appears in the current release, SCOPe 2.08